PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10009336
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family LBD
Protein Properties Length: 235aa    MW: 26465.5 Da    PI: 6.776
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10009336genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260116.51.6e-361188178
       DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavg 78
                 +CaaCk+lrrkC+++C++apyfp +qp+kfa vhk+FGasnv kllk+l+  +reda++sl+yeAe r+rdPvyG+v+
  Lus10009336 11 PCAACKFLRRKCTQECIFAPYFPPDQPQKFASVHKVFGASNVAKLLKELSAVQREDAVNSLAYEAEERLRDPVYGCVA 88
                 7***************************************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.95110111IPR004883Lateral organ boundaries, LOB
PfamPF031954.4E-361188IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MMSSSLSSNS PCAACKFLRR KCTQECIFAP YFPPDQPQKF ASVHKVFGAS NVAKLLKELS  60
AVQREDAVNS LAYEAEERLR DPVYGCVASN VAKLLKELSA VQREDAVNSL ALHHDLELAR  120
RELANYIGAP TPHQQQYQNY PSYPNHNQQE VRFNGGGLGG NYEITRNYIN YEQIQSGNNA  180
EAAQVFFQTR QQEGENGHFD YNRKMLRRRT AAAGDQEEDR EVEVDRGLLM RPTC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011039214.12e-54PREDICTED: LOB domain-containing protein 36 isoform X1
RefseqXP_011039215.12e-54PREDICTED: LOB domain-containing protein 36 isoform X1
RefseqXP_011039216.11e-54PREDICTED: LOB domain-containing protein 36 isoform X2
SwissprotQ9FKZ36e-52LBD36_ARATH; LOB domain-containing protein 36
TrEMBLB9HE743e-54B9HE74_POPTR; Uncharacterized protein
STRINGPOPTR_0007s11460.19e-54(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.13e-51ASYMMETRIC LEAVES 2-like 1